VeganoryThe exact processing ingredient and its source are not listed.
Is Dorset Cereals tasty toasted spelt flaked muesli vegan?
Dorset Cereals · Barcode 5018357012435 · Automated ingredient assessment
Vegan-labelled in the source
The product record carries a vegan label. Our ingredient check still cannot resolve unspecified processing aid. Compare the label on your package.
What needs checkingunspecified processing aid
22 ingredient entries checkedSource record: 2020-09-06
Based on the recorded recipe, not certification. Match it with your current package.
Make it easier to recognise.Add a package photo
What the ingredient list tells us
Dried fruit (32%)[sultanas, chopped dates, golden raisins (2%) (golden raisins, preservative sulphur dioxide), raisins], toasted barley flakes (barley, salt), spelt (wheat) flakes (19%) spelt (wheat), salt, emulsifier (sunflower lecithin)), wholegrain oat flakes, nuts (7%) [roasted whole hazelnuts (4%), sliced almonds], pumpkin seeds (4%)
Source ingredient text. Check it against your current package; recognition and source data can contain errors.
Ingredients with an unresolved source
Additional evidence
The source data identifies this product as vegan.
The source data identifies this product as vegetarian, which does not by itself confirm vegan status.
Recognised ingredient entries (22)
dried fruitsultanaschopped datesgolden raisinsgolden raisinspreservative sulphur dioxideraisinstoasted barley flakesbarleysaltspeltwheatflakesspeltwheatsaltsunflower lecithinwholegrain oat flakesnutsroasted whole hazelnutssliced almondspumpkin seeds
Allergens, trace warnings & additives
Allergen names found in the ingredient text
WheatTree nuts
Detected from the recipe text, not a complete allergen declaration or an allergy-safety assessment.
Declared allergens in the record
glutennutssulphur dioxide and sulphites
Precautionary “may contain” information
No trace statement is recorded. Absence of data does not mean absence of cross-contact.
Trace warnings are kept separate from recipe ingredients. Do not use this page to decide whether food is safe for an allergy.
Additives listed
e220e322e322i
Labels reported by the source
vegetarianveganno added sugarpalm oil free
These are source labels, not certifications independently verified by Veganory.
Nutrition & processing, separately explained
- Source Nutri-Score
- A
- Source NOVA group
- 4 of 4
- Veganory indicator
- 77/100
- Indicator inputs
- Nutrition + processing
Nutri-Score is the grade reported in the source, not a score calculated or certified by us. NOVA describes processing. The Veganory indicator is a separate estimate; it does not determine whether a product is vegan.
| Energy | 375 kcal |
|---|---|
| Fat | 7.7 g |
| Saturated fat | 1 g |
| Carbohydrate | 61.7 g |
| Sugars | 21.4 g |
| Fibre | 7.6 g |
| Protein | 11 g |
| Salt | 0.28 g |
| Sodium | 0.112 g |
How our indicator is calculated
When available, Nutri-Score A–E maps to 92, 74, 55, 34 or 16 points. With NOVA present, we combine 80% of those points with 20% of the processing indicator (100, 82, 52 or 16 for groups 1–4). Without NOVA we use the nutrition points alone. Without a usable Nutri-Score, we do not rate the product. This is a simplified comparison aid, not a validated health assessment.
Vegan alternatives to explore
Compare the product type and ingredient evidence, then check the individual label. Availability in your country or shop is not confirmed.
Alara Gluten Free Fruity Oats MuesliAlaraSame breakfast cereal type · labelled veganVegan label reported in source data · Close product match
Simply Delicious Muesli nuts raisins sunflower seedsDorset Cereals,Simply DeliciousSame breakfast cereal type · labelled veganVegan label reported in source data · Close product match
Luscious Berry and Cherry MuesliDorset cerealsSame breakfast cereal type · labelled veganVegan label reported in source data · Close product match
Fruit Nut MuesliTesco, Caterers prideSame breakfast cereal type · labelled veganVegan label reported in source data · Close product matchNot sponsored. Product similarity is not a safety or certification score. Photos: community contributions and Open Food Facts (CC BY-SA).
Questions about this product
Is this answer valid for every Dorset Cereals product?
No. This page covers Dorset Cereals tasty toasted spelt flaked muesli, barcode 5018357012435. Other flavours, package versions or recipes sold in different countries may differ. Match the barcode and ingredient list on your package.
What still needs to be confirmed?
The source of unspecified processing aid needs clarification. Check the current package for a vegan certification or ask the manufacturer about these exact ingredients. A confidence label is not a certification.
Is the nutrition rating the same as the vegan result?
No. Vegan status concerns ingredient origin. Nutri-Score describes a nutrition profile, NOVA describes processing, and the Veganory score is our own combination of available indicators. A vegan result does not mean a food is nutritionally balanced.
What if my label is different?
Use the current package as your reference. Open a personal check or add a clear ingredient photo below. Community evidence is reviewed before shared information changes; this page is not proof of a manufacturer review.
Sources & how this page is made
Product data: Open Food Facts record for 5018357012435 · Open Database License (ODbL).
Source record updated . This is not the date a person checked your package.
Veganory automatically analyses the available ingredient text, source labels and ingredient rules. We have not taste-tested this product, certified it or independently confirmed its current recipe with the manufacturer.
Read our checking method and limitations. Recipes can change. Compare the current label, especially for strict dietary requirements.
Got another product in your basket?
Scan its barcode, check the ingredients and keep your finds together. You can start right here in your browser.