VeganoryWe could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
Is Hela Curry Gewürz Ketchup delikat vegan?
Hela · Barcode 4027400168372 · Automated ingredient assessment
Unconfirmed: chilis, modifizierte maissstärke, Acid
We found no confirmed animal-derived ingredient, but the origin or meaning of chilis, modifizierte maissstärke, Acid is unresolved. This is not a confirmed vegan result.
What needs checkingchilis, modifizierte maissstärke, Acid, Thickener
21 ingredient entries checkedSource record: 2022-02-11
Based on the recorded recipe, not certification. Match it with your current package.
Make it easier to recognise.Add a package photo
What the ingredient list tells us
Original label (source language)
Tomatensaft, Zucker, Dextrose, Kochsalz, Curry (Senfmehl, Pfeffer, Paprika, Chilis, Nelken, Gewürze), Branntweinessig, modifizierte Maissstärke, Säuerungsmittel: Citronensäure, Verdickungsmittel: (Guarkernmehl, Johannisbrotkernmehl), Kräuter (enthält Sellerie), Säureregulator: Natriumlactat, Geschmacksverstärker: Mononatriumglutamat
Source ingredient text. Check it against your current package; recognition and source data can contain errors.
Ingredients with an unresolved source
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
This ingredient name is in the source dictionary, but it is not yet covered by a verified assessment. This is not evidence of animal origin.
This ingredient name is in the source dictionary, but it is not yet covered by a verified assessment. This is not evidence of animal origin.
This ingredient name is in the source dictionary, but it is not yet covered by a verified assessment. This is not evidence of animal origin.
Recognised ingredient entries (21)
tomatensaftzuckerdextrosekochsalzcurrysenfmehlpfefferpaprikachilisnelkengewürzebranntweinessigmodifizierte maissstärkesäuerungsmittel: citronensäureverdickungsmittelguarkernmehljohannisbrotkernmehlkräuterenthält selleriesäureregulator: natriumlactatgeschmacksverstärker: mononatriumglutamat
Allergens, trace warnings & additives
Declared allergens in the record
mustard
Precautionary “may contain” information
No trace statement is recorded. Absence of data does not mean absence of cross-contact.
Trace warnings are kept separate from recipe ingredients. Do not use this page to decide whether food is safe for an allergy.
Additives listed
e325e330e412e621
Labels reported by the source
no glutenno lactosepalm oil freevegan status unknownvegetarian status unknown
These are source labels, not certifications independently verified by Veganory.
Nutrition & processing, separately explained
- Source Nutri-Score
- D
- Source NOVA group
- 4 of 4
- Veganory indicator
- 30/100
- Indicator inputs
- Nutrition + processing
Nutri-Score is the grade reported in the source, not a score calculated or certified by us. NOVA describes processing. The Veganory indicator is a separate estimate; it does not determine whether a product is vegan.
| Energy | 135 kcal |
|---|---|
| Fat | 0.3 g |
| Saturated fat | 0.1 g |
| Carbohydrate | 31.3 g |
| Sugars | 30.1 g |
| Protein | 0.5 g |
| Salt | 2.3 g |
| Sodium | 0.92 g |
How our indicator is calculated
When available, Nutri-Score A–E maps to 92, 74, 55, 34 or 16 points. With NOVA present, we combine 80% of those points with 20% of the processing indicator (100, 82, 52 or 16 for groups 1–4). Without NOVA we use the nutrition points alone. Without a usable Nutri-Score, we do not rate the product. This is a simplified comparison aid, not a validated health assessment.
Vegan alternatives to explore
Compare the product type and ingredient evidence, then check the individual label. Availability in your country or shop is not confirmed.
Curry Doux Bio 30GJardin bioSame seasoning type · labelled veganVegan label reported in source data · Close product match
Bruschetta Pomodori e OliveCollegrande,ValbonaSame seasoning type · labelled veganVegan label reported in source data · Close product matchNot sponsored. Product similarity is not a safety or certification score. Photos: community contributions and Open Food Facts (CC BY-SA).
Questions about this product
Is this answer valid for every Hela product?
No. This page covers Hela Curry Gewürz Ketchup delikat, barcode 4027400168372. Other flavours, package versions or recipes sold in different countries may differ. Match the barcode and ingredient list on your package.
What still needs to be confirmed?
The source of chilis, modifizierte maissstärke, Acid, Thickener, Acidity regulator needs clarification. Check the current package for a vegan certification or ask the manufacturer about these exact ingredients. A confidence label is not a certification.
Is the nutrition rating the same as the vegan result?
No. Vegan status concerns ingredient origin. Nutri-Score describes a nutrition profile, NOVA describes processing, and the Veganory score is our own combination of available indicators. A vegan result does not mean a food is nutritionally balanced.
What if my label is different?
Use the current package as your reference. Open a personal check or add a clear ingredient photo below. Community evidence is reviewed before shared information changes; this page is not proof of a manufacturer review.
Sources & how this page is made
Product data: Open Food Facts record for 4027400168372 · Open Database License (ODbL).
Source record updated . This is not the date a person checked your package.
Veganory automatically analyses the available ingredient text, source labels and ingredient rules. We have not taste-tested this product, certified it or independently confirmed its current recipe with the manufacturer.
Read our checking method and limitations. Recipes can change. Compare the current label, especially for strict dietary requirements.
Got another product in your basket?
Scan its barcode, check the ingredients and keep your finds together. You can start right here in your browser.