Is Nuovo Pasta Gold Fish Shaped Ravioli! vegan?

Nuovo Pasta · Barcode 0008006996013 · Automated ingredient assessment

The short answer

No — not vegan

Contains cheese, ricotta, milk. Contains cheese, ricotta, and 4 other ingredients, which are animal-derived.

Why it is not vegancheese, ricotta, milk, whey
37 ingredient entries checkedSource record: 2020-10-09

Based on the recorded recipe, not certification. Match it with your current package.

Nuovo Pasta Gold Fish Shaped Ravioli! package
Make it easier to recognise.Add a package photo
Photo: Open Food Facts · CC BY-SA 3.0
Evidence, not a guess

What the ingredient list tells us

Filling: ricotta cheese (milk, whey, cream, vinegar, salt, natural stabilizers [xanthan gum, locust bean gum, guar gum]), cheese powder (dehydrated blend of whey, cheese [granular and cheddar {pasteurized milk, cheese culture, salt, enzymes}], buttermilk solids, whey protein concentrate, salt), mozzarella cheese (pasteurized whole milk, culture, salt, enzymes), eggs, breadcrumbs (wheat flour, evaporated cane syrup, yeast, sea salt), milk, annatto oil. pasta: durum flour, water, eggs, annatto oil.

Source ingredient text. Check it against your current package; recognition and source data can contain errors.

Animal-derived ingredients identified

cheese

Cheese is a dairy product.

ricotta

ricotta is classified as animal-derived by the local ingredient taxonomy.

milk

Milk is an animal-derived dairy ingredient.

whey

Whey is derived from milk.

cream

Cream is dairy-derived unless explicitly identified as plant-based.

egg

Egg is an animal-derived ingredient.

Ingredients with an unresolved source

Stabiliser

This ingredient name is in the source dictionary, but it is not yet covered by a verified assessment. This is not evidence of animal origin.

unspecified oil

The oil source is not identified as plant-derived.

filling

The source or production method of filling can vary, so it is not always vegan.

enzymes

Food enzymes can be microbial, plant-derived, or animal-derived unless their source is stated.

microbial culture

The source or production method of microbial culture can vary, so it is not always vegan.

breadcrumbs

The source or production method of breadcrumbs can vary, so it is not always vegan.

pasta

The source or production method of pasta can vary, so it is not always vegan.

Recognised ingredient entries (37)
filling: ricotta cheesemilkwheycreamvinegarsaltnatural stabilizersxanthan gumlocust bean gumguar gumcheese powderdehydrated blend of wheycheesegranular and cheddarpasteurized milkcheese culturesaltenzymesbuttermilk solidswhey protein concentratesaltmozzarella cheesepasteurized whole milkculturesaltenzymeseggsbreadcrumbswheat flourevaporated cane syrupyeastsea saltmilkannatto oil. pasta: durum flourwatereggsannatto oil

Allergens, trace warnings & additives

Allergen names found in the ingredient text

WheatMilkEgg

Detected from the recipe text, not a complete allergen declaration or an allergy-safety assessment.

Declared allergens in the record

eggsglutenmilk

Precautionary “may contain” information

No trace statement is recorded. Absence of data does not mean absence of cross-contact.

Trace warnings are kept separate from recipe ingredients. Do not use this page to decide whether food is safe for an allergy.

Additives listed

e410e412e415

Labels reported by the source

palm oil freenon veganvegetarian status unknown

These are source labels, not certifications independently verified by Veganory.

Nutrition & processing, separately explained

Source Nutri-Score
C
Source NOVA group
4 of 4
Veganory indicator
47/100
Indicator inputs
Nutrition + processing

Nutri-Score is the grade reported in the source, not a score calculated or certified by us. NOVA describes processing. The Veganory indicator is a separate estimate; it does not determine whether a product is vegan.

Source values per 100 g or 100 ml, as supplied by the record. Confirm the basis on the package; these are not per-serving values.
Energy270 kcal
Fat8 g
Saturated fat5 g
Carbohydrate34 g
Sugars5 g
Fibre2 g
Protein13 g
Salt1.05 g
Sodium0.42 g
How our indicator is calculated

When available, Nutri-Score A–E maps to 92, 74, 55, 34 or 16 points. With NOVA present, we combine 80% of those points with 20% of the processing indicator (100, 82, 52 or 16 for groups 1–4). Without NOVA we use the nutrition points alone. Without a usable Nutri-Score, we do not rate the product. This is a simplified comparison aid, not a validated health assessment.

Vegan alternatives to explore

Compare the product type and ingredient evidence, then check the individual label. Availability in your country or shop is not confirmed.

Vegan Plant-Based Fish Free Steaks packageVegan Plant-Based Fish Free SteaksVBitesSame fish type · labelled veganVegan label reported in source data · Close product matchVegan smoked salmon packageVegan smoked salmonSophie's KitchenSame fish type · labelled veganVegan label reported in source data · Close product match

Not sponsored. Product similarity is not a safety or certification score. Photos: community contributions and Open Food Facts (CC BY-SA).

Questions about this product

Is this answer valid for every Nuovo Pasta product?

No. This page covers Nuovo Pasta Gold Fish Shaped Ravioli!, barcode 0008006996013. Other flavours, package versions or recipes sold in different countries may differ. Match the barcode and ingredient list on your package.

What still needs to be confirmed?

The source of Stabiliser, unspecified oil, filling, enzymes, microbial culture, breadcrumbs, pasta needs clarification. Check the current package for a vegan certification or ask the manufacturer about these exact ingredients. A confidence label is not a certification.

Is the nutrition rating the same as the vegan result?

No. Vegan status concerns ingredient origin. Nutri-Score describes a nutrition profile, NOVA describes processing, and the Veganory score is our own combination of available indicators. A vegan result does not mean a food is nutritionally balanced.

What if my label is different?

Use the current package as your reference. Open a personal check or add a clear ingredient photo below. Community evidence is reviewed before shared information changes; this page is not proof of a manufacturer review.

Sources & how this page is made

Product data: Open Food Facts record for 0008006996013 · Open Database License (ODbL).

Source record updated . This is not the date a person checked your package.

Veganory automatically analyses the available ingredient text, source labels and ingredient rules. We have not taste-tested this product, certified it or independently confirmed its current recipe with the manufacturer.

Read our checking method and limitations. Recipes can change. Compare the current label, especially for strict dietary requirements.

Your next vegan find starts here

Got another product in your basket?

Scan its barcode, check the ingredients and keep your finds together. You can start right here in your browser.