VeganoryCheese is a dairy product.
Is Trattoria Alfredo Deliziosa Salame vegan?
Trattoria Alfredo · Barcode 20001674 · Automated ingredient assessment
No — not vegan
Contains cheese, edam, salami. Contains cheese, edam, and 3 other ingredients, which are animal-derived.
Why it is not vegancheese, edam, salami, pork meat
33 ingredient entries checkedSource record: 2022-02-11
Based on the recorded recipe, not certification. Match it with your current package.
Make it easier to recognise.Add a package photo
What the ingredient list tells us
Original label (source language)
_Weizenmehl_, 30% passierte Tomaten, 15,2% Käse (7,6% schnittfester _Mozzarella_, 7,6% _Edamer_), 12,5% geräucherte Salami (Schweinefleisch, Speck, Speisesalz, Konservierungsstoff: Natriumnitrit; Gewürze, Antioxidationsmittel: Natriumascorbat, Extrakt aus Rosmarin; Gewürzextrakt, Dextrose, Buchenholzrauch), Rapsöl, Backhefe, Zucker, Speisesalz, Trinkwasser, natives Olivenöl extra, Basilikum, modifizierte Stärke, Oregano, Paprikapulver, Schwarzer Pfeffer, getrockneter _Weizensauerteig_, _Weizenquellmehl_, geröstetes Malzmehl (_Weizen_, _Gerste_), Gewürzextrakt.
Source ingredient text. Check it against your current package; recognition and source data can contain errors.
Animal-derived ingredients identified
edam is classified as animal-derived by the local ingredient taxonomy.
salami is classified as animal-derived by the local ingredient taxonomy.
pork meat is classified as animal-derived by the local ingredient taxonomy.
Meat is animal-derived.
Ingredients with an unresolved source
The exact processing ingredient and its source are not listed.
This ingredient name is in the source dictionary, but it is not yet covered by a verified assessment. This is not evidence of animal origin.
Recognised ingredient entries (33)
weizenmehlpassierte tomatenkäseschnittfester mozzarellaedamergeräucherte salamischweinefleischspeckspeisesalzkonservierungsstoff: natriumnitritgewürzeantioxidationsmittel: natriumascorbatextrakt aus rosmaringewürzextraktdextrosebuchenholzrauchrapsölbackhefezuckerspeisesalztrinkwassernatives olivenöl extrabasilikummodifizierte stärkeoreganopaprikapulverschwarzer pfeffergetrockneter weizensauerteigweizenquellmehlgeröstetes malzmehlweizengerstegewürzextrakt
Allergens, trace warnings & additives
Declared allergens in the record
glutenmilk
Precautionary “may contain” information
celeryeggsmustardsesame seedssoybeans
Trace warnings are kept separate from recipe ingredients. Do not use this page to decide whether food is safe for an allergy.
Additives listed
e14xxe250e301e392
Labels reported by the source
fscfsc mixmade in germanypalm oil freenon vegannon vegetarian
These are source labels, not certifications independently verified by Veganory.
Nutrition & processing, separately explained
- Source Nutri-Score
- C
- Source NOVA group
- 4 of 4
- Veganory indicator
- 47/100
- Indicator inputs
- Nutrition + processing
Nutri-Score is the grade reported in the source, not a score calculated or certified by us. NOVA describes processing. The Veganory indicator is a separate estimate; it does not determine whether a product is vegan.
| Energy | 233 kcal |
|---|---|
| Fat | 9.4 g |
| Saturated fat | 4 g |
| Carbohydrate | 25.5 g |
| Sugars | 3.1 g |
| Protein | 10.5 g |
| Salt | 1.1 g |
| Sodium | 0.44 g |
How our indicator is calculated
When available, Nutri-Score A–E maps to 92, 74, 55, 34 or 16 points. With NOVA present, we combine 80% of those points with 20% of the processing indicator (100, 82, 52 or 16 for groups 1–4). Without NOVA we use the nutrition points alone. Without a usable Nutri-Score, we do not rate the product. This is a simplified comparison aid, not a validated health assessment.
Vegan alternatives to explore
Compare the product type and ingredient evidence, then check the individual label. Availability in your country or shop is not confirmed.
Vegan Italian Cheese Style SauceHellmann'sSame cheese type · labelled veganVegan label reported in source data · Close product match
Dairy free mozzarellaMade With PlantsSame cheese type · labelled veganVegan label reported in source data · Close product match
Veggie aroma mozzarellaMediterraneaSame cheese type · labelled veganVegan label reported in source data · Close product matchNot sponsored. Product similarity is not a safety or certification score. Photos: community contributions and Open Food Facts (CC BY-SA).
Questions about this product
Is this answer valid for every Trattoria Alfredo product?
No. This page covers Trattoria Alfredo Deliziosa Salame, barcode 20001674. Other flavours, package versions or recipes sold in different countries may differ. Match the barcode and ingredient list on your package.
What still needs to be confirmed?
The source of unspecified processing aid, Antioxidant needs clarification. Check the current package for a vegan certification or ask the manufacturer about these exact ingredients. A confidence label is not a certification.
Does “may contain” make it non-vegan?
A precautionary trace statement describes possible cross-contact, not an ingredient intentionally included in the recipe. We keep it separate from the recipe assessment. This distinction does not establish allergy safety.
Is the nutrition rating the same as the vegan result?
No. Vegan status concerns ingredient origin. Nutri-Score describes a nutrition profile, NOVA describes processing, and the Veganory score is our own combination of available indicators. A vegan result does not mean a food is nutritionally balanced.
What if my label is different?
Use the current package as your reference. Open a personal check or add a clear ingredient photo below. Community evidence is reviewed before shared information changes; this page is not proof of a manufacturer review.
Sources & how this page is made
Product data: Open Food Facts record for 20001674 · Open Database License (ODbL).
Source record updated . This is not the date a person checked your package.
Veganory automatically analyses the available ingredient text, source labels and ingredient rules. We have not taste-tested this product, certified it or independently confirmed its current recipe with the manufacturer.
Read our checking method and limitations. Recipes can change. Compare the current label, especially for strict dietary requirements.
Got another product in your basket?
Scan its barcode, check the ingredients and keep your finds together. You can start right here in your browser.