Veganorydairy is classified as animal-derived by the local ingredient taxonomy.
Is Valentina Mediterrnean Toast Onions vegan?
Valentina · Barcode 8436551190235 · Automated ingredient assessment
No — not vegan
Contains dairy. Contains dairy, which is animal-derived.
Why it is not vegandairy
23 ingredient entries checkedSource record: 2020-05-30
Based on the recorded recipe, not certification. Match it with your current package.
Make it easier to recognise.Add a package photo
What the ingredient list tells us
Original label (French)
Farine de blé, huile de tournesol raffinée (24%), oi nonsfÏtsdéshydratK.5% (oignon, .hyile.de toumesol antiagg et Contient du gluten. Contient des traces de cacahuètes, sola, dérivés laitiers et sésame. Pour apprécier le roduit â son meilleur, consommer dans les 5 jours après P'ouverture. Conserver dans un endroit frais et sec. Ne pas au soleil. Fabriqué en Espagne. DE IIEjSTETESBRCTMlTZWlEBEL Zutafi Weizenmehl, raffiniertes Sonnenblumenôl (24%), dehydriért gebratenenZwiebeln 5% (Zwiebel, raffiniertes Sonrnblumenôl), Sall Hefe, Mehlbehandlunosmittel (Weienmehl, Trennmittel E - 170i, EmulgatorË-472e, Antiolationsmittel E?300und Enzyme) und ZuckeL Enthâlt Gluten.tlthâlt Spuren von Erdnüssen, Soja, Milchderivaten und sesam.lll optimalen der Geschmackseiqens - chaftenwiflemnfnhlgn dia Q
Source ingredient text. Check it against your current package; recognition and source data can contain errors.
Animal-derived ingredients identified
Ingredients with an unresolved source
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
The exact processing ingredient and its source are not listed.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
Food enzymes can be microbial, plant-derived, or animal-derived unless their source is stated.
We could not identify this ingredient reliably. Check the label spelling; this is a recognition gap, not evidence of animal origin.
Recognised ingredient entries (23)
farine de bléhuile de tournesol raffinéeoi nonsfïtsdéshydratkoignonhyile.de toumesol antiagg et contient du gluten. contient des traces de cacahuètessoladérivés laitiers et sésame. pour apprécier le roduit â son meilleurconsommer dans les 5 jours après p'ouverture. conserver dans un endroit frais et sec. ne pas au soleil. fabriqué en espagne. de iiejstetesbrctmltzwlebel zutafi weizenmehlraffiniertes sonnenblumenôldehydriért gebratenenzwiebelnzwiebelraffiniertes sonrnblumenôlsall hefemehlbehandlunosmittelweienmehltrennmittel e170iemulgatorë 472eantiolationsmittel e?300und enzymeund zuckel enthâlt gluten.tlthâlt spuren von erdnüssensojamilchderivaten und sesam.lll optimalen der geschmackseiqenschaftenwiflemnfnhlgn dia q
Allergens, trace warnings & additives
Declared allergens in the record
gluten
Precautionary “may contain” information
milkpeanutssesame seedssoybeans
Trace warnings are kept separate from recipe ingredients. Do not use this page to decide whether food is safe for an allergy.
Additives listed
No additives are listed in the available record. This is not an additive-free certification.
Labels reported by the source
made in spainpalm oil content unknownnon veganvegetarian status unknown
These are source labels, not certifications independently verified by Veganory.
Nutrition & processing, separately explained
- Source Nutri-Score
- Not available
- Source NOVA group
- Not available
- Veganory indicator
- Not rated
- Indicator inputs
- Insufficient data
Nutri-Score is the grade reported in the source, not a score calculated or certified by us. NOVA describes processing. The Veganory indicator is a separate estimate; it does not determine whether a product is vegan.
| Energy | 524 kcal |
|---|---|
| Fat | 29.6 g |
| Saturated fat | 3.1 g |
| Carbohydrate | 55.6 g |
| Sugars | 2.4 g |
| Fibre | 1.1 g |
| Protein | 8.1 g |
| Salt | 1.675 g |
| Sodium | 0.67 g |
How our indicator is calculated
When available, Nutri-Score A–E maps to 92, 74, 55, 34 or 16 points. With NOVA present, we combine 80% of those points with 20% of the processing indicator (100, 82, 52 or 16 for groups 1–4). Without NOVA we use the nutrition points alone. Without a usable Nutri-Score, we do not rate the product. This is a simplified comparison aid, not a validated health assessment.
Vegan alternatives to explore
Compare the product type and ingredient evidence, then check the individual label. Availability in your country or shop is not confirmed.
No close alternatives are available in this page snapshot. Open the product check to try the live lookup.
Not sponsored. Product similarity is not a safety or certification score. Photos: community contributions and Open Food Facts (CC BY-SA).
Questions about this product
Is this answer valid for every Valentina product?
No. This page covers Valentina Mediterrnean Toast Onions, barcode 8436551190235. Other flavours, package versions or recipes sold in different countries may differ. Match the barcode and ingredient list on your package.
What still needs to be confirmed?
The source of oi nonsfïtsdéshydratk, sola, raffiniertes sonnenblumenôl, raffiniertes sonrnblumenôl, mehlbehandlunosmittel, weienmehl, unspecified processing aid, 170i, emulgatorë-472e, enzymes, chaftenwiflemnfnhlgn dia q needs clarification. Check the current package for a vegan certification or ask the manufacturer about these exact ingredients. A confidence label is not a certification.
Does “may contain” make it non-vegan?
A precautionary trace statement describes possible cross-contact, not an ingredient intentionally included in the recipe. We keep it separate from the recipe assessment. This distinction does not establish allergy safety.
Is the nutrition rating the same as the vegan result?
No. Vegan status concerns ingredient origin. Nutri-Score describes a nutrition profile, NOVA describes processing, and the Veganory score is our own combination of available indicators. A vegan result does not mean a food is nutritionally balanced.
What if my label is different?
Use the current package as your reference. Open a personal check or add a clear ingredient photo below. Community evidence is reviewed before shared information changes; this page is not proof of a manufacturer review.
Sources & how this page is made
Product data: Open Food Facts record for 8436551190235 · Open Database License (ODbL).
Source record updated . This is not the date a person checked your package.
Veganory automatically analyses the available ingredient text, source labels and ingredient rules. We have not taste-tested this product, certified it or independently confirmed its current recipe with the manufacturer.
Read our checking method and limitations. Recipes can change. Compare the current label, especially for strict dietary requirements.
Got another product in your basket?
Scan its barcode, check the ingredients and keep your finds together. You can start right here in your browser.